PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G191600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WRKY
Protein Properties Length: 382aa    MW: 39631.1 Da    PI: 7.9561
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G191600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.52.7e-33183240259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         +Dgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers +dp vv++tYeg+H+h+
  Brast01G191600.1.p 183 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCVVKKRVERSFQDPAVVITTYEGKHTHP 240
                         8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-34167242IPR003657WRKY domain
SuperFamilySSF1182901.96E-29174242IPR003657WRKY domain
PROSITE profilePS5081132.214177242IPR003657WRKY domain
SMARTSM007745.7E-39182241IPR003657WRKY domain
PfamPF031069.1E-26183240IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MSGEFQFHDE LASLFAQRPG SGMQQEQQQA SWFADYLQAG TPMAMDYDLL CRALELPVVE  60
DVVVKREQQV VDAPGGGGGC ALTPSGGTPN TTSSMSSSSS EAGGGGGGGG GGGGGAGDQG  120
DSAGRCKKEE GDGEGGKGDD DEGDKCSKKG AAAGKGGKAG KGEKRPRQPR FAFMTKSEVD  180
HLEDGYRWRK YGQKAVKNSP YPRSYYRCTT QKCVVKKRVE RSFQDPAVVI TTYEGKHTHP  240
IPSALRGSTH LLAAQAAHLH HQHLHGAGHL GLLQAPQMGG SPFGRSTGAG GIDVLGGLLQ  300
PRAHLHHGAM APPMSHGQQM AGSVTGVGSA TAMATSSSPP SLQMQHLMSQ DFGLLQDMLP  360
SFIHGASSNQ PAASSPYGKL H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-27173243878Probable WRKY transcription factor 4
2lex_A1e-27173243878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3580521e-155AK358052.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1067K13.
GenBankAK3668371e-155AK366837.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2047E06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569516.11e-146PREDICTED: probable WRKY transcription factor 71
TrEMBLI1HQ591e-146I1HQ59_BRADI; Uncharacterized protein
STRINGBRADI2G45900.11e-145(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.11e-49WRKY DNA-binding protein 71